NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071351_1023641

Scaffold Ga0071351_1023641


Overview

Basic Information
Taxon OID3300005044 Open in IMG/M
Scaffold IDGa0071351_1023641 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0048
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1330
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7026Long. (o)-83.236Alt. (m)Depth (m)2.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007918Metagenome / Metatranscriptome342Y
F010534Metagenome / Metatranscriptome302N

Sequences

Protein IDFamilyRBSSequence
Ga0071351_10236412F007918AGAAGMCDITLEESDPFLNLELDIEAGIKQELLSILANVETVTEAMNKAILKEEDRREQFRILCSSIDYLFGENIKVIEKRKDDLEEIDPSLHSIACTLSTRMERLRDVAIKPDLKSMKTGIRRVLSQQRIEKFQTNPQQEEQRPQKG*
Ga0071351_10236413F010534AGAAGGMSDRIGEKQETIMNLIDQQIKGALKDQASRLEILQERIKDAIDIGTTEHSQGVKQVMLFVTKAHVQAWIASLKHKVDTAGDDCEICDLERILGEESLEIAEAVKVALNNRNEEARKRVLGELLEETTTKIEALSVRVPQVPQP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.