NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068511_1002784

Scaffold Ga0068511_1002784


Overview

Basic Information
Taxon OID3300005057 Open in IMG/M
Scaffold IDGa0068511_1002784 Open in IMG/M
Source Dataset NameMarine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1937
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameEast Sea, Korea
CoordinatesLat. (o)37.0Long. (o)131.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031892Metagenome / Metatranscriptome181Y
F066695Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0068511_10027841F066695N/AMAELLTDDIIIDALNDDGIMEEPDANWLLEYIESEYGGKLDKDSNWSENKHELKIYSESTADGYDIYWCTYDEKPYVSEDGYQYEAYDDWSEQAIEALTDSQNVWIESHIWEDMEYEFNHALEQWWSDIYEDKFNDKKDELLDSDDYYEDKE*
Ga0068511_10027843F031892N/AMTNLEFNALVHELDSHAQETMNKKGPEYTMQDEDVLNNFKSTAKKLGIDPLIVWYAYFDKQVSSVAAHVSNEDLNKAEPMISRFGDIINYAKLGYALFKERDNI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.