Scaffold Ga0071350_1216728

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071350_1216728

Scaffold Ga0071350_1216728

Overview

Basic Information
Taxon OID	3300005069 Open in IMG/M
Scaffold ID	Ga0071350_1216728 Open in IMG/M
Source Dataset Name	Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	658
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location Name	Lake Fryxell, Antarctica
Coordinates	Lat. (^o)	-77.611214	Long. (^o)	163.119356	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037074	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071350_12167281	F037074	N/A	SKQVEEDKKPQEVYNRLVSIFQKNQYGYHTRIMSDFDLLLEAVLNERFIDDSSAYYDDPVLSKEIEDMEQGLQSDFSESDVKHLLKEKDGGHHDSKKCVRFPARFGTNYDKSDDLSVYKVLPKGQKPLV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.