Basic Information | |
---|---|
Taxon OID | 3300005073 Open in IMG/M |
Scaffold ID | Ga0071347_1009889 Open in IMG/M |
Source Dataset Name | Cellulose enrichment metagenome from thermal spring in Terrace, British Columbia, Canada |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Leibniz Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2684 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Sediment → Cellulose Enrichment Metagenome From Thermal Spring In Terrace, British Columbia, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Terrace, B.C. Canada | |||||||
Coordinates | Lat. (o) | 54.358506 | Long. (o) | -128.541159 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003125 | Metagenome / Metatranscriptome | 506 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071347_10098892 | F003125 | N/A | MDSDPFRIARTSWSPGDTREVETWRVDRQVGLEYDSYRRVYLADGREWIIAGQIARPDGKKYYVLECVG* |
⦗Top⦘ |