Scaffold Ga0071116_1002591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071116_1002591

Scaffold Ga0071116_1002591

Overview

Basic Information
Taxon OID	3300005077 Open in IMG/M
Scaffold ID	Ga0071116_1002591 Open in IMG/M
Source Dataset Name	Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21672
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida

Source Dataset Sampling Location
Location Name	North Port, Florida
Coordinates	Lat. (^o)	27.074722	Long. (^o)	-82.233333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001057	Metagenome / Metatranscriptome	791	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071116_100259121	F001057	N/A	MQTTVELDASNRIVLSRELRRAAGIPRRQKLKVSATPGRIVLEMEPNASGRIIKRGKLKVWTCTVPATPIEEAVEQSRHYTR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.