NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062594_100083275

Scaffold Ga0062594_100083275


Overview

Basic Information
Taxon OID3300005093 Open in IMG/M
Scaffold IDGa0062594_100083275 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1826
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.4Long. (o)-85.37Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028279Metagenome192Y
F092677Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0062594_1000832752F092677N/AMLVAAGCGGRGAQPDHQAEWRDVLRHKKAAASSDATPHQKQVYADSVRAFVTKHPNHGRAREVWQRIQLEFANDLVAMGRYQDAIHFYRAVIAHDPSNEDAKRGIAGAMAHLAVTREKLLALEKGMSHREVAQLLGKPVPGWQVTNSRPGVTMEAWYYRMQGGGLAAVYFRNGKVLAAEETSDARLGRFSS*
Ga0062594_1000832754F028279GAGMSIYAEAKQIKRRADTLLEEIFRSLFEEIDMDKLRTEVNALRAAAPDFKPSQLARTLARRTGIRCAAAGAVTGLPLGLAAIGTLGADLAYLMYQQFR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.