Scaffold Ga0072724_108134

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0072724_108134

Scaffold Ga0072724_108134

Overview

Basic Information
Taxon OID	3300005100 Open in IMG/M
Scaffold ID	Ga0072724_108134 Open in IMG/M
Source Dataset Name	Cold seep microbial communities from the Ulleung Basin, East Sea, Korea - Hemire mound
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Macrogen
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	2742
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Cold Seep → Cold Seep Microbial Communities From The Ulleung Basin, East Sea, Korea

Source Dataset Sampling Location
Location Name	Hemire Mound, Ulleung Basin East Sea, Korea
Coordinates	Lat. (^o)	36.098	Long. (^o)	130.0788	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088916	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072724_1081345	F088916	GGAG	MPSTILDNVKGSDFPKIWADKIDIIPDKTYTVIIQPQEERQSLKKIMSKISRNAKTRGMTPDILEDILGEKVKHIL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.