Basic Information | |
---|---|
Taxon OID | 3300005144 Open in IMG/M |
Scaffold ID | Ga0068711_1012006 Open in IMG/M |
Source Dataset Name | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2847 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New Jersey, Arthur Kill intertidal strait | |||||||
Coordinates | Lat. (o) | 40.58 | Long. (o) | -74.2 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019675 | Metagenome | 228 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068711_10120062 | F019675 | N/A | MLRTRQIILVVTAILGVLLIVRGAWGGVWPPSIQLIAGVLLLVFAGLRWWTMR* |
⦗Top⦘ |