NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073158_1003253

Scaffold Ga0073158_1003253


Overview

Basic Information
Taxon OID3300005191 Open in IMG/M
Scaffold IDGa0073158_1003253 Open in IMG/M
Source Dataset NameE5 T8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Alicante
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1202
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Mallorca 2014 E5

Source Dataset Sampling Location
Location NameSalinas de Campos (Mallorca)
CoordinatesLat. (o)39.338015Long. (o)3.051796Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074460Metagenome119N

Sequences

Protein IDFamilyRBSSequence
Ga0073158_10032533F074460AGGAGGMYYYCPHCLTWRADSYVRIDHRTRIPQCTYCDEFVNARLSDGAYKALVKQHAMEVPAPGDL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.