Scaffold Ga0068645_1057697

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068645_1057697

Scaffold Ga0068645_1057697

Overview

Basic Information
Taxon OID	3300005249 Open in IMG/M
Scaffold ID	Ga0068645_1057697 Open in IMG/M
Source Dataset Name	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	942
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming: Yellowstone National Park
Coordinates	Lat. (^o)	44.539	Long. (^o)	-110.798	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078344	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068645_10576972	F078344	N/A	PMQIARASGWVNLAGQPVFHETLVPTENLVVVLPALRFWASLSPQQRRAALEGERLLPERMTPKQRELFLQVFSRPLPDLVGARLLKRYVHEGNYGSLSVRIGSQGETITMTTRIGNPPPPHFRIGRSVQRIEKTLITMQSEDGSGVTLEGYQTSDFLRPSSGSPRGWLLYFAVDDWQRAYILLGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.