Scaffold Ga0074072_1019328

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074072_1019328

Scaffold Ga0074072_1019328

Overview

Basic Information
Taxon OID	3300005260 Open in IMG/M
Scaffold ID	Ga0074072_1019328 Open in IMG/M
Source Dataset Name	Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Centre for Ecogenomics
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2601
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar

Source Dataset Sampling Location
Location Name	Sydney
Coordinates	Lat. (^o)	-33.917926	Long. (^o)	151.235347	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088481	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074072_10193283	F088481	AGG	MKVAAKEEDRKALDYFTSQITPVQTLRACAVLQLRHAFMLVGFAAVAMALVRFLLAD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.