NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065704_10099157

Scaffold Ga0065704_10099157


Overview

Basic Information
Taxon OID3300005289 Open in IMG/M
Scaffold IDGa0065704_10099157 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2323
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.794771Long. (o)-84.393804Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036344Metagenome / Metatranscriptome170Y
F064075Metagenome129N

Sequences

Protein IDFamilyRBSSequence
Ga0065704_100991572F036344N/AMRRGDQPAGIARFIVTGGSRYAALSKLRVYYDTSDIDSLTATPISGIIPIAGALVHDMRRATPEAEAPQAHEKPDASDDDEPWKRSA*
Ga0065704_100991573F064075N/ARVGEGVPRCQLHLWAIGAEPAWRTLGGTAKVHLADPPIGAIVSPMRPHTLVTALAVAVLSATTAGAQASTQSGQSAAQSSSPCHRCLNGFRFVPSSVVDEPFTNTSFENATGGGMALNLNVPVRKLDGDTIGTLNGNIGFFLLDFEYQKSVAKWLALRVGVNGIGRLGTSLEALVASGISAAMGGYIGATVPVWSKPNFLISAVADLKNNKQWDVDPYSFAKDVVDSGYNDTTKAVLLSSERVNRWSFGLRGAWAVKPWMGLTANIEPGGADGEVSGNKSLSTFGALAGFDLHKLWDVPISTTLAYRVRTGSGKSGNISGGYRSAQLGVYYNALREVLIGGDFFYSTIRVQGGSIPDLDAIQFRLVTHIDF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.