NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065715_10006894

Scaffold Ga0065715_10006894


Overview

Basic Information
Taxon OID3300005293 Open in IMG/M
Scaffold IDGa0065715_10006894 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3931
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan State University
CoordinatesLat. (o)42.406189Long. (o)-85.40016Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002416Metagenome561Y
F032806Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0065715_100068942F032806GGAGMRARPVRPNIYLPVVRFGVADSDWFSVLLISCICYLAPVPFGITLLYVPLQMWTWLLTTTGAIAFFNYIRIGRKPYWLQHQVKALFSNHRQYRFIPNSRKSRFDRLWITDQQEHGRSPPKPSITVNSLLLQHNNSVQEACEENGTAFGL*
Ga0065715_100068943F002416GGAGGMNHLIQTINASALGNSCAVRIGRRLVEIGFGLKAAHGLVAVILSILLGVASVSAQTPSGQFFNGDSTQLGNSLRSVTFFLAAAMIIAGIIFIAVGIITSGLRESLSTWKFITGAACFAFGGVCAAIYAFSQGETVPVDNQF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.