NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065715_10125709

Scaffold Ga0065715_10125709


Overview

Basic Information
Taxon OID3300005293 Open in IMG/M
Scaffold IDGa0065715_10125709 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2124
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan State University
CoordinatesLat. (o)42.406189Long. (o)-85.40016Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024167Metagenome207Y

Sequences

Protein IDFamilyRBSSequence
Ga0065715_101257091F024167AGGAGMSLVTLAVMYGHLEGAGGNFARDPTGHLSIEAGIFEKHGLQVSWNHVQGTEERYRRLETGSAQISLVVGRASLQHFLAAKTTRILGVAMNRCPYYLIAPPAIGTLADLKRKVVACREGPSRNTPIAETFLERADLRIGADLFLQLPSGDQDAFDLLIEGQAHAALLPRPFGFIAEERGFKRIEEWPEIVDDPLPITIETTAKLWSEREKELRTFLNAHSEGIRYFKTHRADAVAVLTKRFGHSAALAEKTFDNYITCMDDTLQVDFRDFEKLLSQIAPETSERARQIAAEWIVPAAVKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.