NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070670_100219536

Scaffold Ga0070670_100219536


Overview

Basic Information
Taxon OID3300005331 Open in IMG/M
Scaffold IDGa0070670_100219536 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1654
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040395Metagenome / Metatranscriptome162Y
F043689Metagenome / Metatranscriptome156Y
F050357Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0070670_1002195362F043689AGGAGGMTTLYDTVRIEAPKRSPVRPASPLDPSWNDGSEIPSSERSVQDRSRSTQWDRLAMGHGQSLWREAA*
Ga0070670_1002195363F050357AGGAGVEGIRLWRASRQKLVGMVYLDKGVLDLDIQDDRERALVEDVLEQTGQVTWSFSRFDEGEWQENIAEPRTERWLWFVVANILYPMGYQADLGISEDG*
Ga0070670_1002195364F040395AGGGGGMLGIIGAGAGIPPEMSNATSWTMAEGFVLLVGYVLAFVVAVWFVAWVDRKLSSRRLFREIYRELGIGRRPPR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.