Basic Information | |
---|---|
Taxon OID | 3300005346 Open in IMG/M |
Scaffold ID | Ga0074242_12178728 Open in IMG/M |
Source Dataset Name | Saline sediment microbial community from Etoliko Lagoon, Greece |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 955 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Etoliko Lagoon, Greece | |||||||
Coordinates | Lat. (o) | 38.482158 | Long. (o) | 21.313175 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065233 | Metagenome | 128 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074242_121787282 | F065233 | N/A | EDAGRRKGLAYHNGDPSGTRYLWGVVEHPTDGRGAVVIGDYTFDLSEEDVSTLSTRDDLDADGWFPSMEELLIPN* |
⦗Top⦘ |