Basic Information | |
---|---|
Taxon OID | 3300005351 Open in IMG/M |
Scaffold ID | Ga0074239_102774 Open in IMG/M |
Source Dataset Name | Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 11689 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (53.85%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Nijmegen, The Netherlands | |||||||
Coordinates | Lat. (o) | 51.842 | Long. (o) | 5.858 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061392 | Metagenome / Metatranscriptome | 132 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074239_1027745 | F061392 | AGGAG | VIVKRLYIICTIFIVGLFMPLQTFASGLDEPDPAFKLAAALSPIDGGELYVGNVDRDKKTFRLHLRHIGKNSKWVYYYASASAFVNEDGDVEPDNAVASLVYPQYTASVIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGFE* |
⦗Top⦘ |