NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070675_100000078

Scaffold Ga0070675_100000078


Overview

Basic Information
Taxon OID3300005354 Open in IMG/M
Scaffold IDGa0070675_100000078 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)56469
Total Scaffold Genes74 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)52 (70.27%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016854Metagenome / Metatranscriptome244Y
F031439Metagenome / Metatranscriptome182Y
F081191Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0070675_10000007815F031439AGGMYVIPIVLIILLALIAVAWSPIFALVFFVVGFVAFLAYAGLNRRADEKLAPPEQPGRQPQHEAQGDTGMWGERKPS*
Ga0070675_10000007842F016854GAGMASSRLKTLPKPGEVWLSCPPYLMMARIVAVDLEGESPVVSYELHDDDGSLLQAVEHATLDRGWWRTFQRLEPRFG*
Ga0070675_10000007846F081191N/AVSPRKPLPSPEEIVAAIVALADDGFCRRAELAQRFPRLESRDLRRALRRAVVQGLVIERRGPDGAFHLAVSSEGWNRLRSG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.