NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070659_100773160

Scaffold Ga0070659_100773160


Overview

Basic Information
Taxon OID3300005366 Open in IMG/M
Scaffold IDGa0070659_100773160 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)834
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046295Metagenome / Metatranscriptome151Y
F068656Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0070659_1007731601F068656GGAMRRILVLLVIVAVGAAALAALWIFRGGEISSFIDRYWTVETQSVPIRSIAYEGG
Ga0070659_1007731602F046295N/ADARFSRWIHLAETHGAELIVRPFNKETLSRGVIPEFLDCIGITSSQFRDRAVRRNEAVGPFTVSVARQVLRSIGKDLTWLQARKCKVKLAAYVRENKYTDAGYCGLSDRLARHIEDELRPDNDVFAKALWGKSWGEVFATDVGEQFEPNDFEMCQPDWFTARQLRRAIDTITAFTQQMLQDPTLAVEAPWNKVAHRSGLVSRE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.