NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074246_103

Scaffold Ga0074246_103


Overview

Basic Information
Taxon OID3300005372 Open in IMG/M
Scaffold IDGa0074246_103 Open in IMG/M
Source Dataset NameMarine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter Sample 10334
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14893
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (11.11%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location
Location NameLate winter and summer Antarctic waters
CoordinatesLat. (o)-64.067Long. (o)-64.767Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016456Metagenome / Metatranscriptome247N

Sequences

Protein IDFamilyRBSSequence
Ga0074246_10317F016456N/AMPRKPNYKDLLKKFKKRNIKNPERIATAYVKGLTAGSKKKAAKNLTGIID*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.