NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066867_10001624

Scaffold Ga0066867_10001624


Overview

Basic Information
Taxon OID3300005400 Open in IMG/M
Scaffold IDGa0066867_10001624 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11108
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (52.94%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011190Metagenome / Metatranscriptome294Y
F032237Metagenome / Metatranscriptome180Y
F077161Metagenome / Metatranscriptome117N
F090238Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0066867_1000162411F077161N/AMRNLSVASIQERFDEHKKLHRFEVDKLFEKIKHKPFTEMQYRYLEIGIRHQFIYDIETSDFDPEQNFIICYVGILRDMVTGKIEKVQDAITKKDIKKAVHEQSFNFDERLLQTLSWNMKQAHHVIGHFSTKFDNPYFRSRCLFTKQYDLIPDYGYQFYGDTWRMMKTSMKAKRNTLKNFIRQTTGNDEKTFVDLKYWYITHFKDHKLWQKSMDYIIDHCVKDVKMTYEGLLKVEQFNNIGRTKA*
Ga0066867_1000162412F090238GGAGVHFHVEEGEESHGEYNSHDGTTEIWLGGHMTIWGLFDTLVHESLHEAIEEVVDGTTEKQDHWAIQRLCF*
Ga0066867_1000162414F032237N/AMTEDRFIDKTTSLKTVERVKFSLKNFSKGAKVEISWAFNPEDSMHVDQFLETDPSKNSILIALQGFKTLVESNLGVKILEDE*
Ga0066867_1000162417F011190AGAAGMGMIRQSIHNFIGGLKKSFSGKDYLRNINQCNKCGKPSFFASCLKCEVDDAYRGYKYTK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.