Scaffold Ga0066856_10002848

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066856_10002848

Scaffold Ga0066856_10002848

Overview

Basic Information
Taxon OID	3300005404 Open in IMG/M
Scaffold ID	Ga0066856_10002848 Open in IMG/M
Source Dataset Name	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7051
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (30.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location Name	Pacific Ocean: Eastern Tropical North Pacific
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096285	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066856_100028487	F096285	GGA	MNWLKTAAIGIWIRAHSDLLFRALVSLGIFWIFNSIYSKYEAVLLATNPEKLFIPLYIYTFIILALVIWTLLALRWVSGMAVAKKKVAAKESFTNKPDEYKKIADVASYPKLKTKKDSIIES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.