NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066851_10067154

Scaffold Ga0066851_10067154


Overview

Basic Information
Taxon OID3300005427 Open in IMG/M
Scaffold IDGa0066851_10067154 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1195
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006865Metagenome / Metatranscriptome363Y
F010325Metagenome / Metatranscriptome305Y
F037421Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0066851_100671541F006865AGGMGKFSNRIIKVNDVLYECLGSMSVESTNDKGTEYWKGQWGADSVLRNGNVYYYCRTIINAEFEDI*
Ga0066851_100671542F037421AGGAGMSNKTEDRTYFRELIRKLKELRISAENGEIIVPNDDEDVLAFDELELPITPDIFHKMTSEEKEALFIWLNKDTMPQA*
Ga0066851_100671544F010325AGGMLRKQLVSDKIDQLQLAVERLKSSLVVPSDPGDTGTPIQVVVNALQQIENQIDAIVNLIELEED*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.