Scaffold Ga0074258_109609

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074258_109609

Scaffold Ga0074258_109609

Overview

Basic Information
Taxon OID	3300005443 Open in IMG/M
Scaffold ID	Ga0074258_109609 Open in IMG/M
Source Dataset Name	Wastewater bioreactor microbial communities from Singapore -TA reactor DNA contigs from 4 sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7233
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Terephthalate → Wastewater → Bioreactor → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location
Location Name	National University of Singapore, Singapore
Coordinates	Lat. (^o)	1.332	Long. (^o)	103.756	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064732	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074258_1096093	F064732	GGA	MEAEAEAATAAARERCTMPLALSAERHVRFLSSPMAPGQYIAATATRSIGQLDHPEDTKLGNHPFLGLL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.