 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300005455 Open in IMG/M |
| Scaffold ID | Ga0070663_100927425 Open in IMG/M |
| Source Dataset Name | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 754 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan, Kellogg Biological Station | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009131 | Metagenome / Metatranscriptome | 322 | Y |
| F032187 | Metagenome / Metatranscriptome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070663_1009274251 | F009131 | N/A | SDYWKNHWEKTTAELRSSKERCYEKSMKCVETIKTSFASVGAYSNEGNFVLGDPEGPIDWINGEAEAFEEILSGRGDICAFSGARGIAAILERRGCEHVKSLAQTEAALCIEGIKDPSAEASLVGGKFFTDIWENGGREMAQEIIRKSEKDTHDAREAAEAAEKTADLERRIGID* |
| Ga0070663_1009274252 | F032187 | N/A | MTSNLFTLCITAALSPPPEPVEPLVDPKAKEDDEIIKMAEAIMDKVVDQLLNEAAEVVLKED* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |