Scaffold Ga0078972_1001208

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0078972_1001208

Scaffold Ga0078972_1001208

Overview

Basic Information
Taxon OID	3300005573 Open in IMG/M
Scaffold ID	Ga0078972_1001208 Open in IMG/M
Source Dataset Name	Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	99499
Total Scaffold Genes	100 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	48 (48.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.611006	Long. (^o)	-110.440182	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078331	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0078972_100120899	F078331	N/A	MVVTNKATNSGDIPEKSATLVVKLHKCHIFEKAPSSISDVINETLHEEELAERAQGNEKFKLKKLNVDGFDAELYFDVKDMQNLKLGEVINLIDKLQANDKRIEASFRFEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.