NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0049082_10059833

Scaffold Ga0049082_10059833


Overview

Basic Information
Taxon OID3300005584 Open in IMG/M
Scaffold IDGa0049082_10059833 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1337
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060658Metagenome / Metatranscriptome132Y
F078232Metagenome / Metatranscriptome116N
F097235Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0049082_100598331F078232AGGAGGMPALTAQEIASLSGCFDCLSPGIKQTYIITLLQQIQVALLDAARTTGSAGGLLTVAATAAANPVRRRFVIQNQKAEILYVKFGTGCTTTDYHYVLLSAATVGTPGTSLTFEG
Ga0049082_100598332F097235AGGAMYGQMMGKRKMDGMGRMGSEVETIEFTPPKELRLEGDSGTAMVDWRTTARGTIEIIGFDGITLGGSGQQDVEEVAGAEMEMDDMEEEA*
Ga0049082_100598333F060658N/ARALRVMPFRPEAVNPNMPFMVRDYGGRWKFATNDLGADCSGKPIDNSRGNKGKFIADFQLAVKPEHPEWLEAIFHKVDRGCIEILPTCEPDAEQYAAQNYSSVDPVCPSVIQFTAVIDDASPARYTIGANGILCDDNIVANAAGISVATVPDLIVALQNRWDTEFGVGSGTWSVVVVGGTLIQLSGSSCTNVTLEFAI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.