NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066832_10002940

Scaffold Ga0066832_10002940


Overview

Basic Information
Taxon OID3300005597 Open in IMG/M
Scaffold IDGa0066832_10002940 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF51B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5766
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007121Metagenome / Metatranscriptome357Y
F010942Metagenome / Metatranscriptome297Y
F021857Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0066832_1000294011F007121N/AVFKPILLAIFLLFGVTAPATGNWQIQPSPSVLQDKLQEPTLDKLIDWVPEEVPRTVSFYFDTDGDGKFDLKIAYSLIEAYPCNVYNCVNTITDNGDHWVLPAPGMNYFVIKKWTLYRYADDEDWRGEYRTQQWIFKHPYYDDWLREKFYFLWPNQMQ*
Ga0066832_1000294017F010942AGGAMESNKVKFCAEHQSRASETQILGIRKDIEHLKYVINELEKECEFIKDHFTTKNGERLDDVKVLHGRIEQRQQADLEFHENVRKKVSDRFEKLDDRIRHLDRWKWATWGAFIIIGSLIGYFLPSP
Ga0066832_100029402F021857GGAGGMIIIEKKVVKIKVKSRFCAVCDSKFRWQCKCPNNKVMARQVKKSFHEGKRYRGKRALEYCYDTEKKNENI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.