Basic Information | |
---|---|
Taxon OID | 3300005602 Open in IMG/M |
Scaffold ID | Ga0070762_10055486 Open in IMG/M |
Source Dataset Name | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2195 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New Hampshire, Hubbard Brook experimental Forest | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018443 | Metagenome / Metatranscriptome | 235 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0070762_100554862 | F018443 | AGGAG | MKRAAYVFTFIGLLSLFAGCKKQESDSDAIRTGINQHLASLKTLNLDAMDMSITNVSIQGNTAQAQVEFKPKTGAPQGAGMQVAYSLQKQNGLWVVQDTQPAGGSIQHPGPGENPHMNSNSPASGQSSGSMPNFRDLVPGGAGSNALPPGHPPVQ* |
⦗Top⦘ |