NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074647_1004014

Scaffold Ga0074647_1004014


Overview

Basic Information
Taxon OID3300005611 Open in IMG/M
Scaffold IDGa0074647_1004014 Open in IMG/M
Source Dataset NameSaline surface water microbial communities from Etoliko Lagoon, Greece
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3904
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (93.75%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location NameEtoliko Lagoon, Greece
CoordinatesLat. (o)38.4825Long. (o)21.315Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015793Metagenome / Metatranscriptome252Y
F034356Metagenome / Metatranscriptome175Y
F052274Metagenome / Metatranscriptome143N
F055274Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0074647_10040141F052274AGGAGMNRTLYKKLEDICAREYILNKLSANKFRTFVDFLYDDIRTWDKPMEVSEV
Ga0074647_100401413F015793GAGGMLSIKTFEDRYNNNKKFHHVNMLGLKFRVANNKRSKRKSNKVFYSTDRGLVFNLLPSRYLCLITK*
Ga0074647_100401415F034356AGGAGMTHNDIKKGMRVQLTPIPMISHEPRTAKVMDNMKGITRMVHIEEKNGYFADMGSVYVDEIEYVLYDNDMPEPIELSEAHQKQLQSTKLF*
Ga0074647_10040145F055274GAGGMSDLNNDISNALCNAIDIRETINSNGLSNIKRVHSGTDNEDTLKDLIDDVIYFLEQLNNGGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.