NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074649_1006153

Scaffold Ga0074649_1006153


Overview

Basic Information
Taxon OID3300005613 Open in IMG/M
Scaffold IDGa0074649_1006153 Open in IMG/M
Source Dataset NameSaline sediment microbial communities from Etoliko Lagoon, Greece - sediment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)9994
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location NameGreece: Etoliko Lagoon
CoordinatesLat. (o)38.4825Long. (o)21.315Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009006Metagenome / Metatranscriptome324N

Sequences

Protein IDFamilyRBSSequence
Ga0074649_10061534F009006AGAAGVSSISAKVEVDGLNEALRTLRYIDPQLRRQVDKQMKETVGKDIIPFARRLYPSTDRVSNAANFPRGLSYKQTTAQRGVKIRIKTSARQDQIAGLFLTNSNGAGVIFSTAGKKTRGTAPTRKDNGSGNSAGFIKMLSRFGDPMRALWPAVLEKRDTLEANVEKAVDDLMKTISKELR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.