Scaffold Ga0074649_1017017

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074649_1017017

Scaffold Ga0074649_1017017

Overview

Basic Information
Taxon OID	3300005613 Open in IMG/M
Scaffold ID	Ga0074649_1017017 Open in IMG/M
Source Dataset Name	Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	4421
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location Name	Greece: Etoliko Lagoon
Coordinates	Lat. (^o)	38.4825	Long. (^o)	21.315	Alt. (m)		Depth (m)	25
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032642	Metagenome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074649_10170174	F032642	AGGAGG	VKQPRPEVWRKRSMSVFDTAGLVGALEVLEHHARRLCHHHPDDYLLDGLRNILCSIDELEAAGRFGTVVTDKRKQAMSQHPSGKNRDLTDLLDSPNTHPTATTTPALQEPSGGVDR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.