NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058698_10753416

Scaffold Ga0058698_10753416


Overview

Basic Information
Taxon OID3300005661 Open in IMG/M
Scaffold IDGa0058698_10753416 Open in IMG/M
Source Dataset NameAgave microbial communities from Guanajuato, Mexico - As.Sf.e
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)609
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → Asparagales → Asparagaceae → Asparagoideae → Asparagus → Asparagus officinalis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameGuanajuato, Mexico
CoordinatesLat. (o)21.7658Long. (o)-100.163Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046122Metagenome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0058698_107534161F046122N/ALNNPQCNTPSEDEGEWVINDNISFDYPASVGVFESIMDSSLHMPLHKPSASSIPVEAIEGATLVIPPSKEGQLPIIFGRTQPWGPVTADSSSDSDTPQFFHYTRPARHIMKKMGYDLKHGEGLNFGKGRRSLLRNFVPKGKPANYYDSTRRGLGYVTPTSSAMVQFTDDEPIPSHSASSSEWDSDVSVGMMFENLTVNMTSS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.