NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0077776_1035485

Scaffold Ga0077776_1035485


Overview

Basic Information
Taxon OID3300005753 Open in IMG/M
Scaffold IDGa0077776_1035485 Open in IMG/M
Source Dataset NameMicrobial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1123
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location
Location NameMid-Cayman Rise
CoordinatesLat. (o)18.375Long. (o)-81.797Alt. (m)Depth (m)2370
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003161Metagenome504N

Sequences

Protein IDFamilyRBSSequence
Ga0077776_10354852F003161GAGGLSRSGALDRIDVLLSTITDPAFTAVIRAEPLALSGTPVLAYWIQSRTNGWQTLGDIGSTTTIMVRAYFRLQVSVDVRESIELELWDAMVEVDSKLRSDANLAGNCTDSTVGSATVATMDMGGSLYRTATIPFDLQIYEEVTITP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.