Scaffold Ga0078746_1088016

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0078746_1088016

Scaffold Ga0078746_1088016

Overview

Basic Information
Taxon OID	3300005821 Open in IMG/M
Scaffold ID	Ga0078746_1088016 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aarhus University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	706
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → unclassified Leptolyngbyaceae → Leptolyngbyaceae cyanobacterium JSC-12	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location Name	Aarhus Bay station M5
Coordinates	Lat. (^o)	56.10555	Long. (^o)	10.463333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088916	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078746_10880161	F088916	GGAG	MPSTILDNVKGSDLHKILADRIDISPDKSYTVIIQPQEERQTLQRIMSKISRNAKARGMTPDVLENILGETV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.