Basic Information | |
---|---|
Taxon OID | 3300005822 Open in IMG/M |
Scaffold ID | Ga0078744_1087632 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Aarhus University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 722 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Aarhus Bay station M5 | |||||||
Coordinates | Lat. (o) | 56.10555 | Long. (o) | 10.463333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019256 | Metagenome / Metatranscriptome | 231 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078744_10876322 | F019256 | N/A | MTTPVAGDGTDGTDAAVDLTTFQQLLDKLEGSKKRQQRQKSVEGRRDVYSQGLASMMGNF |
⦗Top⦘ |