NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078910_100679

Scaffold Ga0078910_100679


Overview

Basic Information
Taxon OID3300005835 Open in IMG/M
Scaffold IDGa0078910_100679 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9012
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (80.95%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities

Source Dataset Sampling Location
Location NameAlnarp, Sweden
CoordinatesLat. (o)59.8152338Long. (o)17.6620518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022442Metagenome / Metatranscriptome214Y
F033483Metagenome / Metatranscriptome177Y
F049068Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0078910_10067912F033483GGAGGVTPGDASVTLDIGGLPVVLVLPERDVELMMWTYRANRILQEGRDDE*
Ga0078910_10067913F022442AGGAGGVTFIPAGEARLDLYTDALILDIGRDTFVVPLARLADLTAHRRREVVVFRRYWGDVPGTFRDVEQGLRLRRSQTDRSLMLTEXGRVYTMPIRAVHDVREGREESCXISLLVTDARQLDDAHSRQTVLEVRV*
Ga0078910_10067921F049068N/AIETVIRALRALQACGYDDVEVGSIESRDHTFLLLIGLDGEARFGDRQPGCIAVAPVGVE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.