Scaffold Ga0078910_102477

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0078910_102477

Scaffold Ga0078910_102477

Overview

Basic Information
Taxon OID	3300005835 Open in IMG/M
Scaffold ID	Ga0078910_102477 Open in IMG/M
Source Dataset Name	Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Norwegian Sequencing Centre (NSC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11965
Total Scaffold Genes	29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	24 (82.76%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities

Source Dataset Sampling Location
Location Name	Alnarp, Sweden
Coordinates	Lat. (^o)	59.8152338	Long. (^o)	17.6620518	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018746	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078910_10247711	F018746	GGAG	MRPTSETLNEFEAAVLAALEQSPEKTVLAADLVRTFSTRVGRTSCISRLERMERRGLVRQQAGLPAGS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.