NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078893_10591950

Scaffold Ga0078893_10591950


Overview

Basic Information
Taxon OID3300005837 Open in IMG/M
Scaffold IDGa0078893_10591950 Open in IMG/M
Source Dataset NameExploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7207
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (57.89%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location
Location NamePort Hacking, Australia
CoordinatesLat. (o)-34.1192Long. (o)151.2267Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045112Metagenome / Metatranscriptome153Y
F065844Metagenome / Metatranscriptome127N
F089420Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0078893_1059195012F089420N/AMLAIDLQGIILPANWKFPECNHPIEKWCKNCDYDCETYDRIPHFRKYKELHMWTEKEFEREMKRGKKSKKR*
Ga0078893_1059195013F045112AGGAMVDKIKHWANVCKLHWKEIITMSIALHWMVDLLILGPIVFFLGYLFGVHVGH*
Ga0078893_105919505F065844N/AMKIQNYIEDGFSKVCDVIIHPDRDDQWYYENVDYNFVGPDKKSWLYFIVKGDNIVKCGESGNPLLLETKGANPRWKKGTFSRLGRYINGCTTDTVIREALYNDVKKGKVSVWAKELPVTTVEVQVRGETKIVERSIHKDLEMVYLDHFVTEYGNLPPLNKGRK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.