NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068858_100943342

Scaffold Ga0068858_100943342


Overview

Basic Information
Taxon OID3300005842 Open in IMG/M
Scaffold IDGa0068858_100943342 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)844
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009663Metagenome / Metatranscriptome314Y
F024245Metagenome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0068858_1009433421F009663N/AMHPKTRSHNLYLPATESRETTQKLSFGPKEVDSACSLRKNKSKLRKHKVVHFMHHKTQSHNGYLPATESRETTQKLSFGPKEVDSACSLRKNKTQLRMHKVVHFMHPKTRSHNGYLPATESHETTQKLSFGPKQVDWACLLRKNKTQLRKHKVVHCMHPKTQSHNLYLPATESCETTQKLSFGPKEVDSACSLRKNKSKLRKHKVVHFMH
Ga0068858_1009433422F024245N/AMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIT*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.