NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080003_1008051

Scaffold Ga0080003_1008051


Overview

Basic Information
Taxon OID3300005859 Open in IMG/M
Scaffold IDGa0080003_1008051 Open in IMG/M
Source Dataset NameHot spring microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC2_E (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2880
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameJoseph's Coat, Yellowstone National Park, Washington, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042426Metagenome / Metatranscriptome158N
F048414Metagenome / Metatranscriptome148Y
F063847Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0080003_10080512F048414AGGAGGMFSGELKENASTSLFYSFLLFIFSFVILVAGLNYIWGKPPLVWLPLSVWNLLIDLGIFLAIIIILIVVVRRYI*
Ga0080003_10080516F063847AGGGGGMNRFKKYIFCYDQYSYLQDKMITHHVSIYARNLKEAKDKLIKLGYKDIYIKKRKKDMIE*
Ga0080003_10080518F042426N/AMENNVKRLMDLPLKSIYTVGQGETKSGFEVYYLFEYKSGNFSEKADNVYMIYSTTILGEWMTENFEKLKKAIFELEVEFRDSQYGKKIAVPVKVRKIMDKPKVSFNVDESGF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.