Scaffold Ga0075287_1049551

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075287_1049551

Scaffold Ga0075287_1049551

Overview

Basic Information
Taxon OID	3300005873 Open in IMG/M
Scaffold ID	Ga0075287_1049551 Open in IMG/M
Source Dataset Name	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	575
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location Name	USA: Twitchell Island, California
Coordinates	Lat. (^o)	38.1087	Long. (^o)	-121.653	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023678	Metagenome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075287_10495512	F023678	GAGG	VRLLKTLVNLVVATLVSALGSKLLGAWGMILGFVAGGLAAWWVARNVFDA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.