NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075132_100207

Scaffold Ga0075132_100207


Overview

Basic Information
Taxon OID3300005907 Open in IMG/M
Scaffold IDGa0075132_100207 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome VIRRA1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8742
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (58.82%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Halspiviridae → Salterprovirus → Salterprovirus His1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Lake
CoordinatesLat. (o)-68.8136Long. (o)77.9341Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006730Metagenome366Y

Sequences

Protein IDFamilyRBSSequence
Ga0075132_10020712F006730GGAMGRETTSLFDQRVYAQATPPQDTRDGIIWVDTSVAAKPTKVYSADTESFVSVGITDYSQLENRIIGTQVDQYIDGTLGRFESMGFQTPTNYASSDSIEEYGVVGDSGTLTDGLENYVGYFVDSYEYEIYFSFGGSSDPDADLSFTPSGGLTRVDGLNIPTDPEDTINYSEDDIGGKTVLLSDSANFEPIQVTESDPFSFSYDASANNDTSTYGSANYTVEYSATFNVVTNIPHKHEFNYAN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.