Basic Information | |
---|---|
Taxon OID | 3300005908 Open in IMG/M |
Scaffold ID | Ga0075131_100140 Open in IMG/M |
Source Dataset Name | Saline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 3 Metagenome VIRRA3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4463 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rauer Lake, Antarctica | |||||||
Coordinates | Lat. (o) | -68.8244 | Long. (o) | 77.8344 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051583 | Metagenome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075131_1001406 | F051583 | GGA | MDYTNPEDVANIDEPTHQQEIGLLSGLIDGKFVCVNYRGFLVNRTDNGSIELSRDGEVLGGRYYVTEHNFAGLVEWLNAKVALYGETA* |
⦗Top⦘ |