NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075130_102080

Scaffold Ga0075130_102080


Overview

Basic Information
Taxon OID3300005927 Open in IMG/M
Scaffold IDGa0075130_102080 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Deep Lake, Antarctica, in enrichment culture - Antarctic Deep Lake Metagenome VIREN14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1782
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake Enrichment → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameDeep Lake, Antarctica
CoordinatesLat. (o)-68.5563Long. (o)78.1877Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075727Metagenome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0075130_1020802F075727N/AMERLNKKGWVARDFIIAMLLFSGTLAMFVLMIGSLASDYDNTDVVDAEFSAKFDKFSEDTDRAGEMWKSATSEGGLSLVGTADLLFFSTFRVISLVFSSVVAAGQQMAGFGEFFGIPSEISSIFMVLIFTILTVSIVFIIISSIRSGKEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.