NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066377_10007005

Scaffold Ga0066377_10007005


Overview

Basic Information
Taxon OID3300005934 Open in IMG/M
Scaffold IDGa0066377_10007005 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2802
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002197Metagenome / Metatranscriptome584Y
F002907Metagenome / Metatranscriptome521Y
F030378Metagenome / Metatranscriptome185Y
F031466Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0066377_1000700511F030378AGGAMNSNVPLSSDFSYKKYSLEQLDNWVNDAINCEDLTPQDIYDTIIKCVDESVEYHKKYLTKSIELLSLLKGHREVDFGEGNITLEATQKDWVDFWEETYYPEEHNQYTEEEMDAMCERAATENDKDKCREYNLREAEYYTKRAELDAQYNDPYSKLIKEAGGYEWTPGMKSPGYNV*
Ga0066377_1000700512F002197GGAMYSLKLLAPFIVAMCAEGLTTGQGDHCVIDNKPPNVVKYYEPGKSCYVNGTFYQKCEDRNGTI*
Ga0066377_100070053F031466GGAMTEKSLVMNIVVLGLLILCVGAIIVAGYIHGDMHFAKVLEHLKK*
Ga0066377_100070058F002907GGAGGVKQNPYWFFQKWGIDEPTPLEILTEKVKQLEDKVRLLEDEMTGQSNALYECWNSLDARIDILSEHKTDV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.