Scaffold Ga0066795_10010479

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066795_10010479

Scaffold Ga0066795_10010479

Overview

Basic Information
Taxon OID	3300005938 Open in IMG/M
Scaffold ID	Ga0066795_10010479 Open in IMG/M
Source Dataset Name	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2507
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	68.6137	Long. (^o)	-149.3144	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005729	Metagenome / Metatranscriptome	392	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066795_100104793	F005729	GGAG	MLRLLVMLASIANCAGGLVLIATWAMMWQHVPIIVLFIGASLLVQGAYTILYLRGDLDRWGDLATGALFAGEGLSACIGAGGLIEGVIHNINTADMEMAPVLAGLLMLVQAVLALLYLWVTGRLHPAAQGRTSARG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.