NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070743_10037213

Scaffold Ga0070743_10037213


Overview

Basic Information
Taxon OID3300005941 Open in IMG/M
Scaffold IDGa0070743_10037213 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary, USA - metaG S.697
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1670
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Columbia River Estuary
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F002598Metagenome / Metatranscriptome544Y
F003690Metagenome / Metatranscriptome473Y
F006744Metagenome / Metatranscriptome365Y

Sequences

Protein IDFamilyRBSSequence
Ga0070743_100372132F003690GGAGMTISGILLELNDYGLELDSFLGAIYLPWHTIILTTLAVIAYKVYKRKRAK*
Ga0070743_100372133F001562GGGGGMNKSQFEKDLEIKESFIDLLNDVYPTVKIGYSTFTPAEILECCDPIAFSIGLIEHQDYLAELEDET*
Ga0070743_100372134F002598AGAAGGMATKLYTIESLLVGKNYRSNSRHFEGEIISATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE*
Ga0070743_100372136F006744AGGMNLDEFKKHVLATREASKAEALSVLSATITKSTNERENLNG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.