NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081529_116944

Scaffold Ga0081529_116944


Overview

Basic Information
Taxon OID3300005964 Open in IMG/M
Scaffold IDGa0081529_116944 Open in IMG/M
Source Dataset NameFerrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4239
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameEchinus Geyser, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7220558Long. (o)-110.7021057Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053392Metagenome / Metatranscriptome141N
F066921Metagenome126N

Sequences

Protein IDFamilyRBSSequence
Ga0081529_1169443F053392GAGGMSVPSYVTLTGPQTTVMPASFTIAASALAGTVVQGSILAFGPQSPAVAAPQVPITEVWSIVDLYIIGTVTPDALLSIYINGYPQDINPDLNSLNLNNLTRWKLMQALKLPPASTWFTTITLLGANGTSQQTYTVYFSVIRAPYLPSASSK*
Ga0081529_1169447F066921GGAMGEENPQVSPKAAYNRAVRAEEKAENALNEIASLKNSIDELVRTLKGASQPIQAQSLRPGQMIHTIISEDDEGITEEIVCPTCGTRELRKIPTKVEVKEKPVVPENYIPAPHSVSEVISLLESLHLPDGRTIFESDKFWSKLNEYAQKYVQNQKKR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.