Scaffold Ga0081529_126380

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081529_126380

Scaffold Ga0081529_126380

Overview

Basic Information
Taxon OID	3300005964 Open in IMG/M
Scaffold ID	Ga0081529_126380 Open in IMG/M
Source Dataset Name	Ferrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	6315
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (54.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 1 → Candidatus Marsarchaeota G1 archaeon OSP_C	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Echinus Geyser, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.7220558	Long. (^o)	-110.7021057	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067921	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0081529_1263809	F067921	GGGGG	MYFERINDKILRNGQYLLLSYSGAKNPLQAMFTGFRVVKHNVTTLYYNFATQVPNFLPMAPYGTSPGPTNSPYYIDNFSFSLQQVKNVTDMFKITNTGDAYQVFYGISPSYLRVVNKIQQQFVSVLEQNIYPSPSFVEMGIDGFQSPLNNPSEKTEFIVFVNLTYNVTLMNTATIPIMPAFNFVINRMTLEPLDREELKKAILAGFPIRSLGAVDSSIMISPENYPGLVSLSYKEIYGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.